Javascript must be enabled to continue!
Effects of HNTX-VII on Kv4.2 and Kv4.3 and Molecular Determinants of Kv4.3 Interacting with HNTX-VII
View through CrossRef
Abstract
HNTX-VII is a novel peptide isolated and purified from the venom of the Chinese spider Ornithoctonus hainana, with a relative molecular mass of 3830.973 Da. Electrophysiological experiments have demonstrated that HNTX-VII exhibits minimal effects on TTX-S, TTX-R, and delayed rectifier potassium channels on dorsal root ganglia (DRG), as well as on Kv1.4 and Kv4.1. However, it significantly inhibits Kv4.2 and Kv4.3 currents, with IC50 values of 299.6 ± 6.48 nM and 114.5 ± 5.36 nM, respectively, for Kv4.2 and Kv4.3. The sequence of HNTX-VII, determined by Edman degradation, is ECRYWLGTCSKTGDCCSHLSCSPKHGWCVWDWT. Composed of 33 amino acids and containing 3 pairs of disulfide bonds, this molecule represents a typical inhibitor cystine knot (ICK) motif. Furthermore, HNTX-VII alters the kinetic properties of Kv4.2 and Kv4.3 channels by causing corresponding shifts in their steady-state activation, steady-state inactivation, and inactivation recovery curves. To further investigate the molecular mechanism underlying the interaction between HNTX-VII and Kv4.3 channels, 19 mutants in the extracellular loops of the S1-S2 and S3b-S4 segments of the Kv4.3 channel were designed and constructed using site-directed mutagenesis. Electrophysiological techniques were then employed to assess the inhibitory activity of HNTX-VII against these mutants. Notably, the V282A mutant in the S3b-S4 loop exhibited the most significant reduction in sensitivity to HNTX-VII, with an IC50 value 5.37 times that of the wild-type channel. Therefore, it is inferred that the 282nd amino acid in the extracellular loop of S3b-S4 serves as a crucial site for the interaction between HNTX-VII and Kv4.3.
Title: Effects of HNTX-VII on Kv4.2 and Kv4.3 and Molecular Determinants of Kv4.3 Interacting with HNTX-VII
Description:
Abstract
HNTX-VII is a novel peptide isolated and purified from the venom of the Chinese spider Ornithoctonus hainana, with a relative molecular mass of 3830.
973 Da.
Electrophysiological experiments have demonstrated that HNTX-VII exhibits minimal effects on TTX-S, TTX-R, and delayed rectifier potassium channels on dorsal root ganglia (DRG), as well as on Kv1.
4 and Kv4.
1.
However, it significantly inhibits Kv4.
2 and Kv4.
3 currents, with IC50 values of 299.
6 ± 6.
48 nM and 114.
5 ± 5.
36 nM, respectively, for Kv4.
2 and Kv4.
3.
The sequence of HNTX-VII, determined by Edman degradation, is ECRYWLGTCSKTGDCCSHLSCSPKHGWCVWDWT.
Composed of 33 amino acids and containing 3 pairs of disulfide bonds, this molecule represents a typical inhibitor cystine knot (ICK) motif.
Furthermore, HNTX-VII alters the kinetic properties of Kv4.
2 and Kv4.
3 channels by causing corresponding shifts in their steady-state activation, steady-state inactivation, and inactivation recovery curves.
To further investigate the molecular mechanism underlying the interaction between HNTX-VII and Kv4.
3 channels, 19 mutants in the extracellular loops of the S1-S2 and S3b-S4 segments of the Kv4.
3 channel were designed and constructed using site-directed mutagenesis.
Electrophysiological techniques were then employed to assess the inhibitory activity of HNTX-VII against these mutants.
Notably, the V282A mutant in the S3b-S4 loop exhibited the most significant reduction in sensitivity to HNTX-VII, with an IC50 value 5.
37 times that of the wild-type channel.
Therefore, it is inferred that the 282nd amino acid in the extracellular loop of S3b-S4 serves as a crucial site for the interaction between HNTX-VII and Kv4.
3.
Related Results
Light and electron microscopic analysis of KChIP and Kv4 localization in rat cerebellar granule cells
Light and electron microscopic analysis of KChIP and Kv4 localization in rat cerebellar granule cells
AbstractPotassium channels are key determinants of neuronal excitability. We recently identified KChIPs as a family of calcium binding proteins that coassociate and colocalize with...
Abstract 12913: Serotonin Regulates Qt-interval: Acceleration of Cardiac Repolarization by Enhanced Kv4.3 Membrane Trafficking
Abstract 12913: Serotonin Regulates Qt-interval: Acceleration of Cardiac Repolarization by Enhanced Kv4.3 Membrane Trafficking
Background:
Elevated maternal serotonin (5-hydroxytryptamine, 5-HT) production is an important determinant of normal fetal development. However, what roles the elevated...
[RETRACTED] Keanu Reeves CBD Gummies v1
[RETRACTED] Keanu Reeves CBD Gummies v1
[RETRACTED]Keanu Reeves CBD Gummies ==❱❱ Huge Discounts:[HURRY UP ] Absolute Keanu Reeves CBD Gummies (Available)Order Online Only!! ❰❰= https://www.facebook.com/Keanu-Reeves-CBD-G...
Evaluation of factor VII antigen in factor VII congenital deficiencies with a new ELISA assay
Evaluation of factor VII antigen in factor VII congenital deficiencies with a new ELISA assay
AbstractAn evaluation of a new Enzyme Linked Immunosorbent Assay (ELISA) factor VII:Ag assay in factor VII congenital deficiencies was carried out. This assay was compared to facto...
Kv4 channels sensitive to BmTX3 in rat nervous system: autoradiographic analysis of their distribution during brain ontogenesis
Kv4 channels sensitive to BmTX3 in rat nervous system: autoradiographic analysis of their distribution during brain ontogenesis
AbstractThe binding site distribution of sBmTX3, a chemically synthesized toxin originally purified from the venom of the scorpionButhus martensi, was investigated in adult and dev...
PENGARUH PEMBELAJARAN TATAP MUKA TERBATAS TERHADAP HASIL BELAJAR DITINJAU DARI MOTIVASI BELAJAR ILMU PENGETAHUAN SOSIAL
PENGARUH PEMBELAJARAN TATAP MUKA TERBATAS TERHADAP HASIL BELAJAR DITINJAU DARI MOTIVASI BELAJAR ILMU PENGETAHUAN SOSIAL
The aims of this study were (1) to determine the effect of limited face-to-face learning on social science learning outcomes for VII grade students at MTs Ar Rofiqy Bogor, (2) to d...
Cell-cell contact between adult rat cardiac myocytes regulates Kv1.5 and Kv4.2 K+channel mRNA expression
Cell-cell contact between adult rat cardiac myocytes regulates Kv1.5 and Kv4.2 K+channel mRNA expression
Regulation of voltage-gated K+channel genes represents an important mechanism for modulating cardiac excitability. Here we demonstrate that expression of two K+channel mRNAs is rec...
Reproductive plasticity in both sexes interacts to determine mating behaviour and fecundity
Reproductive plasticity in both sexes interacts to determine mating behaviour and fecundity
AbstractOrganisms alter their phenotype in response to variation in their environment by expressing phenotypic plasticity. Both sexes exhibit such plasticity in response to contras...

